PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400020632
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family WRKY
Protein Properties Length: 328aa    MW: 36208.2 Da    PI: 7.1279
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400020632genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.72.5e-33198255260
                           --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                  WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                           +DgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkver+  d++++ei+Y+g+Hnh+k
  PGSC0003DMP400020632 198 EDGYNWRKYGQKQVKGSENPRSYYKCTFPNCPTKKKVERNL-DGHITEIVYKGSHNHPK 255
                           8****************************************.***************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.5E-27192256IPR003657WRKY domain
PROSITE profilePS5081123.388192256IPR003657WRKY domain
SuperFamilySSF1182904.97E-25193256IPR003657WRKY domain
SMARTSM007743.1E-35197255IPR003657WRKY domain
PfamPF031064.1E-25198254IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MASSGGNMNT FMNSFNSFSS SQFMTSSFSD LLSDNNDNNN NNNKNWGFSD DRIKSFPMIN  60
SSSSPASPSS YLAFPHSLSP SMLLDSPVLF NNSNTLSSPT TGSFGNLNSK EGNSRSSEFS  120
FQSRPATSSS IFQSSAPRNS LEDLMTRQQQ TTEFSTAKTG VKSEVAPIQS FSQENMPNNP  180
APVHYCQPSQ YVREQKAEDG YNWRKYGQKQ VKGSENPRSY YKCTFPNCPT KKKVERNLDG  240
HITEIVYKGS HNHPKPQSTR RSSSQSVQNL AYSNLDVTNQ PNAFHENGQR DSFAVTDNSS  300
ASFGDEDVDQ GSPISKSGEN EPEAKRW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A2e-151992561674WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3663890.0AY366389.1 Solanum chacoense WRKY-type transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006360818.10.0PREDICTED: probable WRKY transcription factor 26
SwissprotQ8S8P57e-47WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLM1AU570.0M1AU57_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000303880.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.17e-47WRKY DNA-binding protein 33
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]